OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC50 (NM_174908) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308965
Recombinant protein of human coiled-coil domain containing 50 (CCDC50), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA305707 Goat Anti-Ymer / CCDC50 Antibody
100 ug
$565.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CCDC50 or NM_174908"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208965 protein sequence
Red=Cloning site Green=Tags(s)

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT
HFTNQQSSTRHFSKSESSHKGFHYKH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_777568
Locus ID 152137
UniProt ID Q8IVM0
Cytogenetics 3q28
RefSeq Size 8421
RefSeq ORF 918
Synonyms C3orf6; DFNA44; YMER
Summary This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. provided by RefSeq, Oct 2008
Protein Categories Growth Factors, Intracellular Proteins, Nervous system Diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC50" proteins (5)
SKU Description Size Price
PH308965 CCDC50 MS Standard C13 and N15-labeled recombinant protein (NP_777568) 10 ug
$3,360.00
LC405969 Lyophilized CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406391 Lyophilized CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405969 Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY406391 Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products