CCDC50 (NM_174908) Human Tagged ORF Clone

SKU
RC208965
CCDC50 (Myc-DDK-tagged)-Human coiled-coil domain containing 50 (CCDC50), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCDC50
Synonyms C3orf6; DFNA44; YMER
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208965 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGTCAGCATCGACCAGTCCAAGCTGCCTGGAGTCAAGGAAGTATGCCGAGATTTTGCTGTCC
TGGAGGACCACACCCTGGCTCACAGCCTGCAGGAACAAGAGATTGAGCATCATTTGGCATCGAACGTTCA
GCGGAACCGTTTGGTCCAGCATGATCTCCAGGTGGCTAAGCAGCTCCAAGAGGAAGATCTGAAAGCGCAG
GCCCAGCTCCAGAAGCGCTACAAAGACCTTGAACAACAAGACTGTGAAATTGCTCAGGAAATTCAGGAGA
AGCTGGCTATTGAGGCAGAGAGACGACGCATTCAGGAGAAGAAGGATGAGGACATAGCTCGCCTTTTGCA
AGAAAAGGAGTTACAGGAAGAGAAAAAGAGAAAGAAACACTTTCCAGAGTTCCCTGCAACCCGTGCTTAT
GCAGATAGTTACTATTATGAAGATGGAGGAATGAAGCCAAGAGTGATGAAAGAAGCTGTATCTACTCCAT
CACGAATGGCCCACAGGGATCAGGAATGGTATGATGCTGAAATTGCCAGAAAACTGCAAGAAGAAGAACT
TTTGGCTACCCAGGTGGACATGAGAGCCGCTCAAGTAGCTCAAGATGAAGAAATCGCTCGACTTCTAATG
GCTGAAGAAAAGAAAGCTTACAAAAAAGCCAAGGAGCGGGAGAAATCATCTTTGGACAAAAGAAAGCAAG
ACCCCGAGTGGAAGCCAAAAACAGCTAAAGCAGCAAATTCCAAGTCAAAAGAGAGTGATGAACCTCACCA
TTCTAAGAATGAAAGGCCAGCACGGCCACCACCACCTATCATGACAGATGGTGAAGATGCGGATTACACT
CATTTTACAAACCAGCAGAGTTCCACACGGCATTTCTCAAAATCAGAGTCCTCTCATAAAGGTTTTCATT
ACAAACAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208965 protein sequence
Red=Cloning site Green=Tags(s)

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT
HFTNQQSSTRHFSKSESSHKGFHYKH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_174908
ORF Size 918 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_174908.4
RefSeq Size 8421 bp
RefSeq ORF 921 bp
Locus ID 152137
UniProt ID Q8IVM0
Cytogenetics 3q28
MW 35.8 kDa
Summary This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:CCDC50 (NM_174908) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208965L1 Lenti ORF clone of Human coiled-coil domain containing 50 (CCDC50), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208965L2 Lenti ORF clone of Human coiled-coil domain containing 50 (CCDC50), transcript variant 1, mGFP tagged 10 ug
$600.00
RC208965L3 Lenti ORF clone of Human coiled-coil domain containing 50 (CCDC50), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC208965L4 Lenti ORF clone of Human coiled-coil domain containing 50 (CCDC50), transcript variant 1, mGFP tagged 10 ug
$600.00
RG208965 CCDC50 (tGFP-tagged) - Human coiled-coil domain containing 50 (CCDC50), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC101288 CCDC50 (untagged)-Human coiled-coil domain containing 50 (CCDC50), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.