CCDC50 (NM_174908) Human Mass Spec Standard

SKU
PH308965
CCDC50 MS Standard C13 and N15-labeled recombinant protein (NP_777568)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208965]
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC208965 protein sequence
Red=Cloning site Green=Tags(s)

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT
HFTNQQSSTRHFSKSESSHKGFHYKH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777568
RefSeq Size 8421
RefSeq ORF 918
Synonyms C3orf6; DFNA44; YMER
Locus ID 152137
UniProt ID Q8IVM0
Cytogenetics 3q28
Summary This gene encodes a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:CCDC50 (NM_174908) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405969 CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406391 CCDC50 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405969 Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 2 100 ug
$665.00
LY406391 Transient overexpression lysate of coiled-coil domain containing 50 (CCDC50), transcript variant 1 100 ug
$436.00
TP308965 Recombinant protein of human coiled-coil domain containing 50 (CCDC50), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.