Cathelicidin (CAMP) (NM_004345) Human Recombinant Protein

SKU TP308872

Recombinant protein of human cathelicidin antimicrobial peptide (CAMP), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208872 protein sequence; Red=Cloning site Green=Tags(s); ; MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD; PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR; KSKEKIGKEFKRIVQRIKDFLRNLVPRTES; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004336
• Locus ID: 820
• UniProt ID: P49913
• Cytogenetics: 3p21.31
• RefSeq Size: 758
• RefSeq ORF: 510
• Synonyms: CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37
• Summary: This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014]
• Protein Families: Secreted Protein, Transmembrane