Cathelicidin (CAMP) (NM_004345) Human Mass Spec Standard

SKU PH308872

CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208872]
• Predicted MW: 19.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC208872 protein sequence; Red=Cloning site Green=Tags(s); ; MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD; PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR; KSKEKIGKEFKRIVQRIKDFLRNLVPRTES; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004336
• RefSeq Size: 758
• RefSeq ORF: 510
• Synonyms: CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37
• Locus ID: 820
• UniProt ID: P49913
• Cytogenetics: 3p21.31
• Summary: This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014]
• Protein Families: Secreted Protein, Transmembrane