LYZL6 (NM_020426) Human Recombinant Protein

SKU
TP308863
Recombinant protein of human lysozyme-like 6 (LYZL6), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208863 protein sequence
Red=Cloning site Green=Tags(s)

MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF
DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY
WLTGCRLR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065159
Locus ID 57151
UniProt ID O75951
Cytogenetics 17q12
RefSeq Size 942
RefSeq ORF 444
Synonyms HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
Summary This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:LYZL6 (NM_020426) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308863 LYZL6 MS Standard C13 and N15-labeled recombinant protein (NP_065159) 10 ug
$3,255.00
LC412477 LYZL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412477 Transient overexpression lysate of lysozyme-like 6 (LYZL6) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.