LYZL6 Rabbit Polyclonal Antibody

SKU TA335498

Rabbit Polyclonal Anti-LYZL6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LYZL6 Antibody: synthetic peptide directed towards the N terminal of human LYZL6. Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: lysozyme like 6
• Database Link:
  NP_065159
  O75951
• Background: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.
• Synonyms: LYC1; PRO1485; TKAL754; UNQ754
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92%; Rabbit: 75%

Reference Data

• Protein Families: Secreted Protein