LYZL6 (NM_020426) Human Mass Spec Standard

SKU PH308863

LYZL6 MS Standard C13 and N15-labeled recombinant protein (NP_065159)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208863]
• Predicted MW: 17 kDa
• Protein Sequence:
  Protein Sequence

  >RC208863 protein sequence; Red=Cloning site Green=Tags(s); ; MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF; DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY; WLTGCRLR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_065159
• RefSeq Size: 942
• RefSeq ORF: 444
• Synonyms: HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
• Locus ID: 57151
• UniProt ID: O75951
• Cytogenetics: 17q12
• Summary: This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Secreted Protein