STING (TMEM173) (NM_198282) Human Recombinant Protein

CAT#: TP308418

Reviews ()
Write a review

Recombinant protein of human transmembrane protein 173 (TMEM173)

Size: 20 ug 100 ug 1 mg



USD 867.00

5 Days*

Size
    • 20 ug

Product images

Other products for "TMEM173"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC208418 protein sequence
Red=Cloning site Green=Tags(s)

MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEEL
RHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLA
PAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPD
NLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFS
REDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSA
VPSTSTMSQEPELLISGMEKPLPLRTDFS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_938023
Locus ID 340061
UniProt ID Q86WV6
Cytogenetics 5q31.2
Refseq Size 2223
Refseq ORF 1137
Synonyms ERIS; hMITA; hSTING; MITA; MPYS; NET23; SAVI; STING; STING-beta; TMEM173
Summary This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.