RAP1GAP (NM_002885) Human Recombinant Protein

SKU
TP308271
Recombinant protein of human RAP1 GTPase activating protein (RAP1GAP), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208271 protein sequence
Red=Cloning site Green=Tags(s)

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETE
PLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHD
VIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEEL
FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQ
QLQRKRHIGNDIVAVVFQDENTPLVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLP
DPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKS
GPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAE
ALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR
SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 73.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002876
Locus ID 5909
UniProt ID P47736
Cytogenetics 1p36.12
RefSeq Size 3334
RefSeq ORF 1989
Synonyms RAP1GA1; RAP1GAP1; RAP1GAPII; RAPGAP
Summary This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this gene, RAP1GAP, promotes the hydrolysis of bound GTP and hence returns RAP1 to the inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitating the conversion of RAP1 from the GDP- to the GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:RAP1GAP (NM_002885) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308271 RAP1GAP MS Standard C13 and N15-labeled recombinant protein (NP_002876) 10 ug
$3,255.00
LC419032 RAP1GAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428957 RAP1GAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419032 Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 3 100 ug
$436.00
LY428957 Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 2 100 ug
$665.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.