RAP1GAP Rabbit Polyclonal Antibody

SKU TA342187

Rabbit polyclonal Anti-RAP1GAP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAP1GAP antibody: synthetic peptide directed towards the middle region of human RAP1GAP. Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: RAP1 GTPase activating protein
• Database Link:
  NP_002876
  P47736
• Background: This gene encodes a type of GTPase-activating-protein (GAP) that down-regulatesThe activity ofThe ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form.The product ofThis gene, RAP1GAP, promotesThe hydrolysis of bound GTP and hence returns RAP1 toThe inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitatingThe conversion of RAP1 fromThe GDP- toThe GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Aug 2011]
• Synonyms: RAP1GA1; RAP1GAP1; RAP1GAPII; RAPGAP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Zebrafish: 86%

Reference Data