RAP1GAP (NM_002885) Human Mass Spec Standard

SKU
PH308271
RAP1GAP MS Standard C13 and N15-labeled recombinant protein (NP_002876)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208271]
Predicted MW 73.3 kDa
Protein Sequence
Protein Sequence
>RC208271 protein sequence
Red=Cloning site Green=Tags(s)

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETE
PLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHD
VIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEEL
FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQ
QLQRKRHIGNDIVAVVFQDENTPLVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLP
DPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKS
GPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAE
ALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR
SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002876
RefSeq Size 3334
RefSeq ORF 1989
Synonyms RAP1GA1; RAP1GAP1; RAP1GAPII; RAPGAP
Locus ID 5909
UniProt ID P47736
Cytogenetics 1p36.12
Summary This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this gene, RAP1GAP, promotes the hydrolysis of bound GTP and hence returns RAP1 to the inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitating the conversion of RAP1 from the GDP- to the GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:RAP1GAP (NM_002885) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419032 RAP1GAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428957 RAP1GAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419032 Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 3 100 ug
$436.00
LY428957 Transient overexpression lysate of RAP1 GTPase activating protein (RAP1GAP), transcript variant 2 100 ug
$665.00
TP308271 Recombinant protein of human RAP1 GTPase activating protein (RAP1GAP), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.