HBLD1 (ISCA2) (NM_194279) Human Recombinant Protein

SKU
TP307304
Recombinant protein of human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207304 protein sequence
Red=Cloning site Green=Tags(s)

MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL
RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA
QQGCSCGSSFSIKL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_919255
Locus ID 122961
UniProt ID Q86U28
Cytogenetics 14q24.3
RefSeq Size 1088
RefSeq ORF 462
Synonyms c14_5557; HBLD1; ISA2; MMDS4
Summary The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:HBLD1 (ISCA2) (NM_194279) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307304 ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255) 10 ug
$3,255.00
LC405117 ISCA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405117 Transient overexpression lysate of iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.