HBLD1 (ISCA2) (NM_194279) Human Tagged ORF Clone

SKU
RC207304
ISCA2 (Myc-DDK-tagged)-Human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HBLD1
Synonyms c14_5557; HBLD1; ISA2; MMDS4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207304 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCGCCTGGGGGTCGTCCCTAACGGCCGCGACGCAGAGAGCGGTCACTCCCTGGCCGAGGGGCA
GGCTCCTCACGGCCTCCCTGGGACCCCAGGCGCGTCGGGAGGCGTCGTCCTCCAGCCCCGAGGCCGGCGA
AGGGCAGATCTGCCTCACAGACAGTTGCGTCCAGAGGCTTTTGGAAATCACCGAAGGGTCAGAATTCCTC
AGGCTGCAAGTGGAGGGAGGTGGATGCTCCGGATTCCAATACAAATTTTCACTGGATACAGTTATCAACC
CCGACGACAGGGTATTTGAACAGGGTGGGGCAAGAGTGGTGGTTGACTCTGATAGCTTGGCCTTCGTGAA
AGGGGCCCAGGTGGACTTCAGCCAAGAACTGATCCGAAGCTCATTTCAAGTGTTGAACAATCCTCAAGCA
CAGCAAGGCTGCTCCTGTGGGTCATCTTTCTCTATCAAACTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207304 protein sequence
Red=Cloning site Green=Tags(s)

MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL
RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA
QQGCSCGSSFSIKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_194279
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_194279.1, NP_919255.1
RefSeq Size 1088 bp
RefSeq ORF 465 bp
Locus ID 122961
UniProt ID Q86U28
Cytogenetics 14q24.3
MW 16.4 kDa
Summary The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:HBLD1 (ISCA2) (NM_194279) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207304L3 Lenti ORF clone of Human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2), Myc-DDK-tagged 10 ug
$450.00
RC207304L4 Lenti ORF clone of Human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2), mGFP tagged 10 ug
$450.00
RG207304 ISCA2 (tGFP-tagged) - Human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2) 10 ug
$489.00
SC107700 ISCA2 (untagged)-Human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.