HBLD1 (ISCA2) (NM_194279) Human Mass Spec Standard

SKU
PH307304
ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207304]
Predicted MW 16.4 kDa
Protein Sequence
Protein Sequence
>RC207304 protein sequence
Red=Cloning site Green=Tags(s)

MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFL
RLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQA
QQGCSCGSSFSIKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_919255
RefSeq Size 1088
RefSeq ORF 462
Synonyms c14_5557; HBLD1; ISA2; MMDS4
Locus ID 122961
UniProt ID Q86U28
Cytogenetics 14q24.3
Summary The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:HBLD1 (ISCA2) (NM_194279) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405117 ISCA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405117 Transient overexpression lysate of iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2) 100 ug
$436.00
TP307304 Recombinant protein of human iron-sulfur cluster assembly 2 homolog (S. cerevisiae) (ISCA2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.