MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein

SKU
TP306888
Recombinant protein of human male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206888 protein sequence
Red=Cloning site Green=Tags(s)

MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED
HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD
EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL
ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA
QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR
STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF
LAEYHDDFFPESAYVAACEAHYSTKNPRAIY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_523353
Locus ID 10943
UniProt ID Q8N5Y2
Cytogenetics Xp22.2
RefSeq Size 2359
RefSeq ORF 1563
Synonyms MRSXBA; MRXS36; MRXSBA; MSL3L1
Summary This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8. [provided by RefSeq, Jul 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306888 MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353) 10 ug
$3,255.00
LC409197 MSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409198 MSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409197 Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 4 100 ug
$665.00
LY409198 Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.