MSL3L1 (MSL3) (NM_078629) Human Mass Spec Standard

SKU
PH306888
MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206888]
Predicted MW 59.8 kDa
Protein Sequence
Protein Sequence
>RC206888 protein sequence
Red=Cloning site Green=Tags(s)

MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED
HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD
EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL
ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA
QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR
STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR
RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF
LAEYHDDFFPESAYVAACEAHYSTKNPRAIY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_523353
RefSeq Size 2359
RefSeq ORF 1563
Synonyms MRSXBA; MRXS36; MRXSBA; MSL3L1
Locus ID 10943
UniProt ID Q8N5Y2
Cytogenetics Xp22.2
Summary This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8. [provided by RefSeq, Jul 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:MSL3L1 (MSL3) (NM_078629) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409197 MSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409198 MSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409197 Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 4 100 ug
$665.00
LY409198 Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 100 ug
$436.00
TP306888 Recombinant protein of human male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.