MSL3L1 (MSL3) Rabbit Polyclonal Antibody

SKU TA345487

Rabbit Polyclonal Anti-MSL3L1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSL3L1 antibody: synthetic peptide directed towards the N terminal of human MSL3L1. Synthetic peptide located within the following region: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: male-specific lethal 3 homolog (Drosophila)
• Database Link:
  NP_523353
  Q8N5Y2
• Background: MSL3L1 is a nuclear protein, which is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms.
• Synonyms: MSL3L1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 86%

Reference Data

• Protein Families: Transcription Factors