Granzyme B (GZMB) (NM_004131) Human Recombinant Protein

SKU TP306495

Purified recombinant protein of Human granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) (GZMB), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206495 protein sequence; Red=Cloning site Green=Tags(s); ; MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIQDDFVLTAAHCWGSSI; NVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQ; TCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCN; KVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH; ; myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 27.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004122
• Locus ID: 3002
• UniProt ID: P10144 Q67BC3
• Cytogenetics: 14q12
• RefSeq Size: 941
• RefSeq ORF: 741
• Synonyms: C11; CCPI; CGL-1; CGL1; CSP-B; CSPB; CTLA1; CTSGL1; HLP; SECT
• Summary: This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis. [provided by RefSeq, Sep 2016]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Allograft rejection, Autoimmune thyroid disease, Graft-versus-host disease, Natural killer cell mediated cytotoxicity, Type I diabetes mellitus