DUSP19 (NM_080876) Human Recombinant Protein

SKU
TP306095
Recombinant protein of human dual specificity phosphatase 19 (DUSP19), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206095 protein sequence
Red=Cloning site Green=Tags(s)

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD
RIQENSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_543152
Locus ID 142679
UniProt ID Q8WTR2
Cytogenetics 2q32.1
RefSeq Size 5379
RefSeq ORF 651
Synonyms DUSP17; LMWDSP3; SKRP1; TS-DSP1
Summary Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:DUSP19 (NM_080876) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306095 DUSP19 MS Standard C13 and N15-labeled recombinant protein (NP_543152) 10 ug
$3,255.00
LC408993 DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428032 DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408993 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 1 100 ug
$436.00
LY428032 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.