OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP19 (NM_080876) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306095
Recombinant protein of human dual specificity phosphatase 19 (DUSP19), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DUSP19 or NM_080876"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206095 protein sequence
Red=Cloning site Green=Tags(s)

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD
RIQENSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_543152
Locus ID 142679
UniProt ID Q8WTR2
Cytogenetics 2q32.1
RefSeq Size 5379
RefSeq ORF 651
Synonyms DUSP17; LMWDSP3; SKRP1; TS-DSP1
Summary Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 PubMed 19228121).supplied by OMIM, Dec 2009
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP19" proteins (5)
SKU Description Size Price
PH306095 DUSP19 MS Standard C13 and N15-labeled recombinant protein (NP_543152) 10 ug
$3,360.00
LC408993 Lyophilized DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428032 Lyophilized DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408993 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428032 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

PTEN regulates invasiveness in pancreatic neuroendocrine tumors through DUSP19-mediated VEGFR3 dephosphorylation
Chang, Chu, Lin et al
J Biomed Sci (2022) 29 (1), 92 DOI: 10.1186/s12929-022-00875-2
Cited by 19
AI Summary: OriGene products contributed to this study by providing PTEN (RC200176) and DUSP19 (RC215527) overexpression plasmids, which were used to manipulate gene expression and investigate their roles in regulating VEGFR3 phosphorylation and invasiveness in pancreatic neuroendocrine tumor cells.
Snippet: VEGFR3 is also expressed in various tumor cells and plays a role in tumor growth and metastasis in many cancer types [13, 14]. However, the functional role of VEGFR3 in pancreatic neuroendocrine tumorigenesis has not been fully explored. In this study, we investigated the roles of PTEN and VEGFR3 in the invasiveness of pNETs, and delineated the molecular mechanisms by which PTEN regulates VEGFR3
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products