OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP19 (NM_080876) Human Mass Spec Standard

Be the first to review this product
SKU
PH306095
DUSP19 MS Standard C13 and N15-labeled recombinant protein (NP_543152)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY428032 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DUSP19 or NM_080876"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206095
Predicted MW 24.2 kDa
Protein Sequence
Protein Sequence
>RC206095 protein sequence
Red=Cloning site Green=Tags(s)

MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIK
PWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAK
RKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCD
RIQENSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_543152
RefSeq Size 5379
RefSeq ORF 651
Synonyms DUSP17; LMWDSP3; SKRP1; TS-DSP1
Locus ID 142679
UniProt ID Q8WTR2
Cytogenetics 2q32.1
Summary Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 PubMed 19228121).supplied by OMIM, Dec 2009
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP19" proteins (5)
SKU Description Size Price
LC408993 Lyophilized DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428032 Lyophilized DUSP19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408993 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428032 Transient overexpression lysate of dual specificity phosphatase 19 (DUSP19), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306095 Recombinant protein of human dual specificity phosphatase 19 (DUSP19), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products