Cofilin 2 (CFL2) (NM_021914) Human Recombinant Protein

SKU
TP305105
Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205105 protein sequence
Red=Cloning site Green=Tags(s)

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL
DDIKDRSTLGEKLGGNVVVSLEGKPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_068733
Locus ID 1073
UniProt ID Q9Y281
Cytogenetics 14q13.1
RefSeq Size 3125
RefSeq ORF 498
Synonyms NEM7
Summary This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
Protein Families Druggable Genome
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:Cofilin 2 (CFL2) (NM_021914) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305105 CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733) 10 ug
$3,255.00
PH322215 CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) 10 ug
$3,255.00
LC403364 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411884 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429663 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403364 Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 2 100 ug
$436.00
LY411884 Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 100 ug
$436.00
TP322215 Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.