Cofilin 2 (CFL2) (NM_138638) Human Mass Spec Standard

SKU PH322215

CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC222215]
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC222215 protein sequence; Red=Cloning site Green=Tags(s); ; MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS; FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL; DDIKDRSTLGEKLGGNVVVSLEGKPL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_619579
• RefSeq Size: 3267
• RefSeq ORF: 498
• Synonyms: NEM7
• Locus ID: 1073
• UniProt ID: Q9Y281
• Cytogenetics: 14q13.1
• Summary: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton