Cofilin 2 (CFL2) (NM_138638) Human Mass Spec Standard

SKU
PH322215
CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222215]
Predicted MW 18.7 kDa
Protein Sequence
Protein Sequence
>RC222215 protein sequence
Red=Cloning site Green=Tags(s)

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL
DDIKDRSTLGEKLGGNVVVSLEGKPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_619579
RefSeq Size 3267
RefSeq ORF 498
Synonyms NEM7
Locus ID 1073
UniProt ID Q9Y281
Cytogenetics 14q13.1
Summary This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
Protein Families Druggable Genome
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:Cofilin 2 (CFL2) (NM_138638) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305105 CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733) 10 ug
$3,255.00
LC403364 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411884 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429663 CFL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403364 Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 2 100 ug
$436.00
LY411884 Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 100 ug
$436.00
TP305105 Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322215 Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.