FAIM1 (FAIM) (NM_001033032) Human Recombinant Protein

SKU TP304411

Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204411 protein sequence; Red=Cloning site Green=Tags(s); ; MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI; SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET; HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001028204
• Locus ID: 55179
• UniProt ID: Q9NVQ4
• Cytogenetics: 3q22.3
• RefSeq Size: 1104
• RefSeq ORF: 537
• Synonyms: FAIM1
• Summary: The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]