FAIM1 (FAIM) (NM_001033032) Human Tagged ORF Clone

SKU
RC204411
FAIM (Myc-DDK-tagged)-Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAIM1
Synonyms FAIM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204411 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGATCTCGTAGCTGTTTGGGATGTTGCTTTAAGTGACGGAGTCCACAAGATCGAATTTGAACATG
GGACTACATCAGGCAAACGAGTAGTATATGTAGATGGAAAGGAAGAGATAAGAAAAGAGTGGATGTTCAA
ATTAGTGGGCAAAGAAACATTCTATGTTGGAGCTGCAAAGACAAAAGCGACCATAAATATAGACGCTATC
AGTGGTTTTGCTTATGAATATACTCTGGAAATTAATGGGAAAAGTCTCAAGAAGTATATGGAGGACAGAT
CAAAAACCACCAATACTTGGGTATTACACATGGATGGTGAGAACTTTAGAATTGTTTTGGAAAAAGATGC
TATGGACGTATGGTGCAATGGTAAAAAATTGGAGACAGCGGGTGAGTTTGTAGATGATGGGACTGAAACT
CACTTCAGTATCGGGAACCATGACTGTTACATAAAGGCTGTCAGTAGTGGGAAGCGGAAAGAAGGGATTA
TTCATACTCTCATTGTGGATAATAGAGAAATCCCAGAGATTGCAAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204411 protein sequence
Red=Cloning site Green=Tags(s)

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI
SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET
HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001033032
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001033032.2
RefSeq Size 1104 bp
RefSeq ORF 540 bp
Locus ID 55179
UniProt ID Q9NVQ4
Cytogenetics 3q22.3
MW 20.2 kDa
Summary The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Write Your Own Review
You're reviewing:FAIM1 (FAIM) (NM_001033032) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204411L3 Lenti ORF clone of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC204411L4 Lenti ORF clone of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, mGFP tagged 10 ug
$600.00
RG204411 FAIM (tGFP-tagged) - Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 10 ug
$500.00
SC321672 FAIM (untagged)-Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.