FAIM1 (FAIM) (NM_001033032) Human Mass Spec Standard

SKU
PH304411
FAIM MS Standard C13 and N15-labeled recombinant protein (NP_001028204)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204411]
Predicted MW 20.2 kDa
Protein Sequence
Protein Sequence
>RC204411 protein sequence
Red=Cloning site Green=Tags(s)

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAKTKATINIDAI
SGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTET
HFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028204
RefSeq Size 1104
RefSeq ORF 537
Synonyms FAIM1
Locus ID 55179
UniProt ID Q9NVQ4
Cytogenetics 3q22.3
Summary The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]
Write Your Own Review
You're reviewing:FAIM1 (FAIM) (NM_001033032) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413277 FAIM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422347 FAIM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413277 Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 4 100 ug
$436.00
LY422347 Transient overexpression lysate of Fas apoptotic inhibitory molecule (FAIM), transcript variant 3 100 ug
$436.00
TP304411 Recombinant protein of human Fas apoptotic inhibitory molecule (FAIM), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762644 Purified recombinant protein of Human Fas apoptotic inhibitory molecule (FAIM), transcript variant 4, full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.