NIP30 (FAM192A) (NM_024946) Human Recombinant Protein
SKU
TP304378
Recombinant protein of human NEFA-interacting nuclear protein NIP30 (NIP30), 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204378 protein sequence
Red=Cloning site Green=Tags(s) MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme substrate (PMID: 29804834) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_079222 |
Locus ID | 80011 |
UniProt ID | Q9GZU8 |
Cytogenetics | 16q13 |
RefSeq Size | 2865 |
RefSeq ORF | 762 |
Synonyms | C16orf94; CDA018; CDA10; FAM192A; NIP30; PIP30 |
Summary | Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304378 | FAM192A MS Standard C13 and N15-labeled recombinant protein (NP_079222) | 10 ug |
$3,255.00
|
|
LC403039 | FAM192A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403039 | Transient overexpression lysate of family with sequence similarity 192, member A (FAM192A) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.