NIP30 (FAM192A) (NM_024946) Human Tagged ORF Clone

SKU
RC204378
FAM192A (Myc-DDK-tagged)-Human family with sequence similarity 192, member A (FAM192A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NIP30
Synonyms C16orf94; CDA018; CDA10; FAM192A; NIP30; PIP30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204378 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGAGGGGATGATGGTAACCTTATTATCAAAAAGAGGTTTGTGTCTGAGGCAGAACTAGATGAAC
GGCGCAAAAGGAGGCAAGAAGAATGGGAGAAAGTTCGAAAACCTGAAGATCCAGAAGAATGTCCAGAGGA
GGTTTATGACCCTCGATCTCTATATGAAAGGCTACAGGAACAGAAGGACAGGAAGCAGCAGGAGTACGAG
GAACAGTTCAAATTCAAAAACATGGTAAGAGGCTTAGATGAAGATGAGACCAACTTCCTTGATGAGGTTT
CTCGACAGCAGGAACTAATAGAAAAGCAACGAAGAGAAGAAGAACTGAAAGAACTGAAGGAATACAGAAA
TAACCTCAAGAAGGTTGGAATTTCTCAAGAGAACAAGAAGGAAGTGGAAAAGAAACTGACTGTGAAGCCT
ATAGAAACCAAGAACAAGTTCTCCCAGGCGAAGCTGTTGGCAGGAGCTGTGAAGCATAAGAGCTCAGAGA
GTGGCAACAGTGTGAAAAGACTGAAACCGGACCCTGAGCCAGATGACAAGAATCAAGAGCCCTCATCCTG
CAAGTCTCTCGGAAACACCTCCCTGAGTGGCCCCTCCATCCACTGCCCCTCTGCTGCAGTATGTATCGGC
ATCCTCCCAGGCCTGGGTGCCTACTCTGGGAGCAGCGACTCCGAGTCCAGCTCAGACAGCGAAGGCACCA
TCAATGCCACCGGAAAGATTGTCTCCTCCATCTTCCGAACCAACACCTTCCTCGAGGCCCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204378 protein sequence
Red=Cloning site Green=Tags(s)

MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE
EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP
IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG
ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024946
ORF Size 762 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024946.4
RefSeq Size 2865 bp
RefSeq ORF 765 bp
Locus ID 80011
UniProt ID Q9GZU8
Cytogenetics 16q13
MW 28.9 kDa
Summary Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NIP30 (FAM192A) (NM_024946) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204378L1 Lenti ORF clone of Human family with sequence similarity 192, member A (FAM192A), Myc-DDK-tagged 10 ug
$600.00
RC204378L2 Lenti ORF clone of Human family with sequence similarity 192, member A (FAM192A), mGFP tagged 10 ug
$600.00
RC204378L3 Lenti ORF clone of Human family with sequence similarity 192, member A (FAM192A), Myc-DDK-tagged 10 ug
$600.00
RC204378L4 Lenti ORF clone of Human family with sequence similarity 192, member A (FAM192A), mGFP tagged 10 ug
$600.00
RG204378 FAM192A (tGFP-tagged) - Human family with sequence similarity 192, member A (FAM192A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC111392 FAM192A (untagged)-Human family with sequence similarity 192, member A (FAM192A) 10 ug
$300.00
SC323743 FAM192A (untagged)-Human family with sequence similarity 192, member A (FAM192A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.