NIP30 (FAM192A) (NM_024946) Human Mass Spec Standard

SKU PH304378

FAM192A MS Standard C13 and N15-labeled recombinant protein (NP_079222)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC204378]
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC204378 protein sequence; Red=Cloning site Green=Tags(s); ; MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYE; EQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKP; IETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIG; ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_079222
• RefSeq Size: 2865
• RefSeq ORF: 762
• Synonyms: C16orf94; CDA018; CDA10; FAM192A; NIP30; PIP30
• Locus ID: 80011
• UniProt ID: Q9GZU8
• Cytogenetics: 16q13
• Summary: Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function]