TEM8 (ANTXR1) (NM_018153) Human Recombinant Protein

SKU
TP304112
Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204112 protein sequence
Red=Cloning site Green=Tags(s)

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA
HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR
TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG
IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL
CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSLHKIASGPTTAACME

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060623
Locus ID 84168
UniProt ID Q9H6X2
Cytogenetics 2p13.3
RefSeq Size 2360
RefSeq ORF 999
Synonyms ATR; GAPO; TEM8
Summary This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TEM8 (ANTXR1) (NM_018153) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304112 ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623) 10 ug
$3,255.00
PH318473 ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262) 10 ug
$3,255.00
LC409333 ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413252 ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409333 Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2 100 ug
$436.00
LY413252 Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3 100 ug
$436.00
TP318473 Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.