TEM8 (ANTXR1) (NM_053034) Human Mass Spec Standard

SKU
PH318473
ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC218473]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC218473 representing NM_053034
Red=Cloning site Green=Tags(s)

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA
HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR
TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG
IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL
CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVI
IKEVPPPPAEESEENKIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_444262
RefSeq Size 1454
RefSeq ORF 1104
Synonyms ATR; GAPO; TEM8
Locus ID 84168
UniProt ID Q9H6X2
Cytogenetics 2p13.3
Summary This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TEM8 (ANTXR1) (NM_053034) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304112 ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623) 10 ug
$3,255.00
LC409333 ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413252 ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409333 Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2 100 ug
$436.00
LY413252 Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3 100 ug
$436.00
TP304112 Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318473 Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.