TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone

SKU
RC204112
ANTXR1 (Myc-DDK-tagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TEM8
Synonyms ATR; GAPO; TEM8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204112 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACGGCGGAGCGGAGAGCCCTCGGCATCGGCTTCCAGTGGCTCTCTTTGGCCACTCTGGTGCTCA
TCTGCGCCGGGCAAGGGGGACGCAGGGAGGATGGGGGTCCAGCCTGCTACGGCGGATTTGACCTGTACTT
CATTTTGGACAAATCAGGAAGTGTGCTGCACCACTGGAATGAAATCTATTACTTTGTGGAACAGTTGGCT
CACAAATTCATCAGCCCACAGTTGAGAATGTCCTTTATTGTTTTCTCCACCCGAGGAACAACCTTAATGA
AACTGACAGAAGACAGAGAACAAATCCGTCAAGGCCTAGAAGAACTCCAGAAAGTTCTGCCAGGAGGAGA
CACTTACATGCATGAAGGATTTGAAAGGGCCAGTGAGCAGATTTATTATGAAAACAGACAAGGGTACAGG
ACAGCCAGCGTCATCATTGCTTTGACTGATGGAGAACTCCATGAAGATCTCTTTTTCTATTCAGAGAGGG
AGGCTAATAGGTCTCGAGATCTTGGTGCAATTGTTTACTGTGTTGGTGTGAAAGATTTCAATGAGACACA
GCTGGCCCGGATTGCGGACAGTAAGGATCATGTGTTTCCCGTGAATGACGGCTTTCAGGCTCTGCAAGGC
ATCATCCACTCAATTTTGAAGAAGTCCTGCATCGAAATTCTAGCAGCTGAACCATCCACCATATGTGCAG
GAGAGTCATTTCAAGTTGTCGTGAGAGGAAACGGCTTCCGACATGCCCGCAACGTGGACAGGGTCCTCTG
CAGCTTCAAGATCAATGACTCGGTCACACTCAATGAGAAGCCCTTTTCTGTGGAAGATACTTATTTACTG
TGTCCAGCGCCTATCTTAAAAGAAGTTGGCATGAAAGCTGCACTCCAGGTCAGCATGAACGATGGCCTCT
CTTTTATCTCCAGTTCTGTCATCATCACCACCACACACTGTAGCCTCCACAAAATTGCATCAGGCCCCAC
AACAGCTGCTTGCATGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204112 protein sequence
Red=Cloning site Green=Tags(s)

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA
HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR
TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG
IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL
CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSLHKIASGPTTAACME

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018153
ORF Size 999 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018153.3
RefSeq Size 2360 bp
RefSeq ORF 1002 bp
Locus ID 84168
UniProt ID Q9H6X2
Cytogenetics 2p13.3
Domains VWA
Protein Families Druggable Genome, Transmembrane
MW 37.1 kDa
Summary This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:TEM8 (ANTXR1) (NM_018153) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204112L1 Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, Myc-DDK-tagged 10 ug
$750.00
RC204112L2 Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, mGFP tagged 10 ug
$750.00
RC204112L3 Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, Myc-DDK-tagged 10 ug
$750.00
RC204112L4 Lenti ORF clone of Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3, mGFP tagged 10 ug
$750.00
RG204112 ANTXR1 (tGFP-tagged) - Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3 10 ug
$650.00
SC321448 ANTXR1 (untagged)-Human anthrax toxin receptor 1 (ANTXR1), transcript variant 3 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.