Neugrin (NGRN) (NM_016645) Human Recombinant Protein
SKU
TP303415
Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC203415 representing NM_016645
Red=Cloning site Green=Tags(s) MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLK KAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNK EIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFD SNGNFLYRI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057729 |
Locus ID | 51335 |
UniProt ID | Q9NPE2 |
Cytogenetics | 15q26.1 |
RefSeq Size | 1782 |
RefSeq ORF | 657 |
Synonyms | DSC92; mesenchymal stem cell protein DSC92; neugrin, neurite outgrowth associated; neurite outgrowth associated protein |
Summary | Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303415 | NGRN MS Standard C13 and N15-labeled recombinant protein (NP_057729) | 10 ug |
$3,255.00
|
|
PH322032 | NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260) | 10 ug |
$3,255.00
|
|
LC413846 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422366 | NGRN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY413846 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 1 | 100 ug |
$436.00
|
|
LY422366 | Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 2 | 100 ug |
$436.00
|
|
TP322032 | Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.