OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Neugrin (NGRN) (NM_016645) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303415
Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA344220 Rabbit Polyclonal Anti-NGRN Antibody - N-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Neugrin or NM_016645"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203415 representing NM_016645
Red=Cloning site Green=Tags(s)

MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLK
KAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNK
EIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFD
SNGNFLYRI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057729
Locus ID 51335
UniProt ID Q9NPE2
Cytogenetics 15q26.1
RefSeq Size 1782
RefSeq ORF 657
Synonyms DSC92; mesenchymal stem cell protein DSC92; neugrin, neurite outgrowth associated; neurite outgrowth associated protein
Summary Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Neugrin" proteins (7)
SKU Description Size Price
PH303415 NGRN MS Standard C13 and N15-labeled recombinant protein (NP_057729) 10 ug
$3,360.00
PH322032 NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260) 10 ug
$3,360.00
LC413846 Lyophilized NGRN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422366 Lyophilized NGRN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413846 Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422366 Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP322032 Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products