Neugrin (NGRN) (NM_016645) Human Mass Spec Standard

SKU
PH303415
NGRN MS Standard C13 and N15-labeled recombinant protein (NP_057729)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203415]
Predicted MW 24.2 kDa
Protein Sequence
Protein Sequence
>RC203415 representing NM_016645
Red=Cloning site Green=Tags(s)

MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLK
KAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNK
EIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFD
SNGNFLYRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057729
RefSeq Size 1782
RefSeq ORF 657
Synonyms DSC92; mesenchymal stem cell protein DSC92; neugrin, neurite outgrowth associated; neurite outgrowth associated protein
Locus ID 51335
UniProt ID Q9NPE2
Cytogenetics 15q26.1
Summary Plays an essential role in mitochondrial ribosome biogenesis. As a component of a functional protein-RNA module, consisting of RCC1L, NGRN, RPUSD3, RPUSD4, TRUB2, FASTKD2 and 16S mitochondrial ribosomal RNA (16S mt-rRNA), controls 16S mt-rRNA abundance and is required for intra-mitochondrial translation of core subunits of the oxidative phosphorylation system.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Neugrin (NGRN) (NM_016645) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH322032 NGRN MS Standard C13 and N15-labeled recombinant protein (NP_001028260) 10 ug
$3,255.00
LC413846 NGRN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422366 NGRN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413846 Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 1 100 ug
$436.00
LY422366 Transient overexpression lysate of neugrin, neurite outgrowth associated (NGRN), transcript variant 2 100 ug
$436.00
TP303415 Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP322032 Purified recombinant protein of Homo sapiens neugrin, neurite outgrowth associated (NGRN), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.