Neugrin (NGRN) Rabbit Polyclonal Antibody

SKU
TA344220
Rabbit Polyclonal Anti-NGRN Antibody - N-terminal region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NGRN antibody: synthetic peptide directed towards the N terminal of human NGRN. Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name neugrin, neurite outgrowth associated
Database Link
Background NGRN may be involved in neuronal differentiation.
Synonyms DSC92
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 79%
Reference Data
Write Your Own Review
You're reviewing:Neugrin (NGRN) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.