Calpain S2 (CAPNS2) (NM_032330) Human Recombinant Protein

SKU TP303338

Recombinant protein of human calpain, small subunit 2 (CAPNS2), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203338 protein sequence; Red=Cloning site Green=Tags(s); ; MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSV; EASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLG; FEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFI; SCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_115706
• Locus ID: 84290
• UniProt ID: Q96L46
• Cytogenetics: 16q12.2
• RefSeq Size: 1040
• RefSeq ORF: 744
• Synonyms: CSS2
• Summary: Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.[UniProtKB/Swiss-Prot Function]