Calpain S2 (CAPNS2) (NM_032330) Human Recombinant Protein

SKU
TP303338
Recombinant protein of human calpain, small subunit 2 (CAPNS2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203338 protein sequence
Red=Cloning site Green=Tags(s)

MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSV
EASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLG
FEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFI
SCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115706
Locus ID 84290
UniProt ID Q96L46
Cytogenetics 16q12.2
RefSeq Size 1040
RefSeq ORF 744
Synonyms CSS2
Summary Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calpain S2 (CAPNS2) (NM_032330) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303338 CAPNS2 MS Standard C13 and N15-labeled recombinant protein (NP_115706) 10 ug
$3,255.00
LC410206 CAPNS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410206 Transient overexpression lysate of calpain, small subunit 2 (CAPNS2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.