OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Calpain S2 (CAPNS2) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342945
Rabbit Polyclonal Anti-CAPNS2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
In Stock*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY410206 Transient overexpression lysate of calpain, small subunit 2 (CAPNS2) (as WB positive control) 100 ug
$436.00
TP303338 Recombinant protein of human calpain, small subunit 2 (CAPNS2), 20 µg
20 ug
$867.00

View other "Calpain S2 or NM_032330" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CAPNS2 antibody: synthetic peptide directed towards the N terminal of human CAPNS2. Synthetic peptide located within the following region: GRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 28 kDa
Gene Name calpain small subunit 2
Database Link
Background CAPNS2 is a calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.
Synonyms MGC12536; MGC14804
Note Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rabbit: 93%; Sheep: 82%; Pig: 79%; Dog: 75%; Rat: 75%; Horse: 75%; Bovine: 75%; Guinea pig: 75%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products