Calpain S2 (CAPNS2) Rabbit Polyclonal Antibody

SKU TA342945

Rabbit Polyclonal Anti-CAPNS2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAPNS2 antibody: synthetic peptide directed towards the N terminal of human CAPNS2. Synthetic peptide located within the following region: GRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: calpain small subunit 2
• Database Link:
  NP_115706
  Q96L46
• Background: CAPNS2 is a calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.
• Synonyms: MGC12536; MGC14804
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rabbit: 93%; Sheep: 82%; Pig: 79%; Dog: 75%; Rat: 75%; Horse: 75%; Bovine: 75%; Guinea pig: 75%

Reference Data