Calpain S2 (CAPNS2) (NM_032330) Human Mass Spec Standard

SKU
PH303338
CAPNS2 MS Standard C13 and N15-labeled recombinant protein (NP_115706)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203338]
Predicted MW 27.7 kDa
Protein Sequence
Protein Sequence
>RC203338 protein sequence
Red=Cloning site Green=Tags(s)

MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSV
EASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLG
FEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFI
SCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115706
RefSeq Size 1040
RefSeq ORF 744
Synonyms CSS2
Locus ID 84290
UniProt ID Q96L46
Cytogenetics 16q12.2
Summary Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Calpain S2 (CAPNS2) (NM_032330) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410206 CAPNS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410206 Transient overexpression lysate of calpain, small subunit 2 (CAPNS2) 100 ug
$436.00
TP303338 Recombinant protein of human calpain, small subunit 2 (CAPNS2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.