Iba1 (AIF1) (NM_032955) Human Recombinant Protein

SKU TP303154

Recombinant protein of human allograft inflammatory factor 1 (AIF1), transcript variant 1, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203154 representing NM_032955; Red=Cloning site Green=Tags(s); ; MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY; EEKAREKEKPTGPPAKKAISELP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_116573
• Locus ID: 199
• UniProt ID: P55008
• Cytogenetics: 6p21.33
• RefSeq Size: 503
• RefSeq ORF: 279
• Synonyms: AIF-1; IBA1; IRT-1; IRT1
• Summary: This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome