Iba1 (AIF1) (NM_032955) Human Mass Spec Standard

SKU PH303154

AIF1 MS Standard C13 and N15-labeled recombinant protein (NP_116573)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203154]
• Predicted MW: 10.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC203154 representing NM_032955; Red=Cloning site Green=Tags(s); ; MEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMY; EEKAREKEKPTGPPAKKAISELP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_116573
• RefSeq Size: 503
• RefSeq ORF: 279
• Synonyms: AIF-1; IBA1; IRT-1; IRT1
• Locus ID: 199
• UniProt ID: P55008
• Cytogenetics: 6p21.33
• Summary: This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]
• Protein Families: Druggable Genome