ARHI (DIRAS3) (NM_004675) Human Recombinant Protein

SKU
TP302787
Recombinant protein of human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202787 protein sequence
Red=Cloning site Green=Tags(s)

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
KKSQMPNTTEKLLDKCIIM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity In vitro kinase assay substrate (negative control) (PMID: 26146988)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004666
Locus ID 9077
UniProt ID O95661
Cytogenetics 1p31.3
RefSeq Size 1642
RefSeq ORF 687
Synonyms ARHI; NOEY2
Summary This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:ARHI (DIRAS3) (NM_004675) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302787 DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666) 10 ug
$3,255.00
LC401484 DIRAS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401484 Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 3 (DIRAS3) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.