ARHI (DIRAS3) (NM_004675) Human Tagged ORF Clone

SKU
RC202787
DIRAS3 (Myc-DDK-tagged)-Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARHI
Synonyms ARHI; NOEY2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202787 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTAACGCCAGCTTTGGCTCCAAGGAACAGAAGCTGCTGAAGCGGTTGCGGCTTCTGCCCGCCCTGC
TTATCCTCCGCGCCTTCAAGCCCCACAGGAAGATCAGAGATTACCGCGTCGTGGTAGTCGGCACCGCTGG
TGTGGGGAAAAGTACGCTGCTGCACAAGTGGGCGAGCGGCAACTTCCGTCATGAGTACCTGCCGACCATT
GAAAATACCTACTGCCAGTTGCTGGGCTGCAGCCACGGTGTGCTTTCCCTGCACATCACCGACAGCAAGA
GTGGCGACGGCAACCGCGCTCTGCAGCGCCACGTTATAGCCCGGGGCCACGCCTTCGTCCTGGTCTACTC
AGTCACCAAGAAGGAAACCCTGGAAGAGCTGAAGGCCTTCTATGAGCTGATCTGCAAGATCAAAGGTAAC
AACCTGCATAAGTTCCCCATCGTGCTGGTGGGCAATAAAAGTGATGACACCCACCGGGAGGTGGCCCTGA
ATGATGGTGCCACCTGTGCGATGGAGTGGAATTGCGCCTTCATGGAGATTTCAGCCAAGACCGATGTGAA
TGTGCAGGAGCTGTTCCACATGCTGCTGAATTACAAGAAAAAGCCCACCACCGGCCTCCAGGAGCCCGAG
AAGAAATCCCAGATGCCCAACACCACTGAGAAGCTGCTTGACAAGTGCATAATCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202787 protein sequence
Red=Cloning site Green=Tags(s)

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
KKSQMPNTTEKLLDKCIIM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004675
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004675.4
RefSeq Size 1642 bp
RefSeq ORF 690 bp
Locus ID 9077
UniProt ID O95661
Cytogenetics 1p31.3
MW 25.9 kDa
Summary This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:ARHI (DIRAS3) (NM_004675) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202787L1 Lenti ORF clone of Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), Myc-DDK-tagged 10 ug
$600.00
RC202787L2 Lenti ORF clone of Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), mGFP tagged 10 ug
$600.00
RC202787L3 Lenti ORF clone of Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), Myc-DDK-tagged 10 ug
$600.00
RC202787L4 Lenti ORF clone of Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), mGFP tagged 10 ug
$600.00
RG202787 DIRAS3 (tGFP-tagged) - Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC125693 DIRAS3 (untagged)-Human DIRAS family, GTP-binding RAS-like 3 (DIRAS3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.