ARHI (DIRAS3) (NM_004675) Human Mass Spec Standard

SKU
PH302787
DIRAS3 MS Standard C13 and N15-labeled recombinant protein (NP_004666)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202787]
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC202787 protein sequence
Red=Cloning site Green=Tags(s)

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTI
ENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGN
NLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPE
KKSQMPNTTEKLLDKCIIM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004666
RefSeq Size 1642
RefSeq ORF 687
Synonyms ARHI; NOEY2
Locus ID 9077
UniProt ID O95661
Cytogenetics 1p31.3
Summary This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:ARHI (DIRAS3) (NM_004675) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401484 DIRAS3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401484 Transient overexpression lysate of DIRAS family, GTP-binding RAS-like 3 (DIRAS3) 100 ug
$436.00
TP302787 Recombinant protein of human DIRAS family, GTP-binding RAS-like 3 (DIRAS3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.