Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Recombinant Protein

SKU
TP301973
Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201973 protein sequence
Red=Cloning site Green=Tags(s)

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG
EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 15 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001435
Locus ID 2171
UniProt ID Q01469
Cytogenetics 8q21.13
RefSeq Size 751
RefSeq ORF 405
Synonyms E-FABP; EFABP; KFABP; PA-FABP; PAFABP
Summary This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Protein Pathways PPAR signaling pathway
Write Your Own Review
You're reviewing:Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301973 FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435) 10 ug
$3,255.00
LC400560 FABP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400560 Transient overexpression lysate of fatty acid binding protein 5 (psoriasis-associated) (FABP5) 100 ug
$436.00
TP720118 Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.