Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Mass Spec Standard

SKU
PH301973
FABP5 MS Standard C13 and N15-labeled recombinant protein (NP_001435)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201973]
Predicted MW 15.2 kDa
Protein Sequence
Protein Sequence
>RC201973 protein sequence
Red=Cloning site Green=Tags(s)

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG
EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001435
RefSeq Size 751
RefSeq ORF 405
Synonyms E-FABP; EFABP; KFABP; PA-FABP; PAFABP
Locus ID 2171
UniProt ID Q01469
Cytogenetics 8q21.13
Summary This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Protein Pathways PPAR signaling pathway
Write Your Own Review
You're reviewing:Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400560 FABP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400560 Transient overexpression lysate of fatty acid binding protein 5 (psoriasis-associated) (FABP5) 100 ug
$436.00
TP301973 Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720118 Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.