Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Tagged ORF Clone

SKU
RC201973
FABP5 (Myc-DDK-tagged)-Human fatty acid binding protein 5 (psoriasis-associated) (FABP5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Fatty Acid Binding Protein 5
Synonyms E-FABP; EFABP; KFABP; PA-FABP; PAFABP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201973 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACAGTTCAGCAGCTGGAAGGAAGATGGCGCCTGGTGGACAGCAAAGGCTTTGATGAATACATGA
AGGAGCTAGGAGTGGGAATAGCTTTGCGAAAAATGGGCGCAATGGCCAAGCCAGATTGTATCATCACTTG
TGATGGTAAAAACCTCACCATAAAAACTGAGAGCACTTTGAAAACAACACAGTTTTCTTGTACCCTGGGA
GAGAAGTTTGAAGAAACCACAGCTGATGGCAGAAAAACTCAGACTGTCTGCAACTTTACAGATGGTGCAT
TGGTTCAGCATCAGGAGTGGGATGGGAAGGAAAGCACAATAACAAGAAAATTGAAAGATGGGAAATTAGT
GGTGGAGTGTGTCATGAACAATGTCACCTGTACTCGGATCTATGAAAAAGTAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201973 protein sequence
Red=Cloning site Green=Tags(s)

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG
EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001444
ORF Size 405 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001444.3
RefSeq Size 751 bp
RefSeq ORF 408 bp
Locus ID 2171
UniProt ID Q01469
Cytogenetics 8q21.13
Domains lipocalin
Protein Pathways PPAR signaling pathway
MW 15.2 kDa
Summary This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Write Your Own Review
You're reviewing:Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201973L1 Lenti ORF clone of Human fatty acid binding protein 5 (psoriasis-associated) (FABP5), Myc-DDK-tagged 10 ug
$450.00
RC201973L2 Lenti ORF clone of Human fatty acid binding protein 5 (psoriasis-associated) (FABP5), mGFP tagged 10 ug
$450.00
RC201973L3 Lenti ORF clone of Human fatty acid binding protein 5 (psoriasis-associated) (FABP5), Myc-DDK-tagged 10 ug
$450.00
RC201973L4 Lenti ORF clone of Human fatty acid binding protein 5 (psoriasis-associated) (FABP5), mGFP tagged 10 ug
$450.00
RG201973 FABP5 (tGFP-tagged) - Human fatty acid binding protein 5 (psoriasis-associated) (FABP5) 10 ug
$489.00
SC119223 FABP5 (untagged)-Human fatty acid binding protein 5 (psoriasis-associated) (FABP5) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.