U1A (SNRPA) (NM_004596) Human Recombinant Protein

SKU
TP301818
Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201818 protein sequence
Red=Cloning site Green=Tags(s)

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA
KK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity : OriGene human recombinant small nuclear ribonucleoprotein polypeptide A (SNRPA, Cat. #TP301818) was compared side-by-side with baculovirus based insect cell (BEVS) derived SNRPA in a phycoerythrin detecting Luminex assay. The human cell produced SNRPA is comparative or better in sensitivity than the insect cell produced SNRPA to detect autoantibodies in human serum samples.
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004587
Locus ID 6626
UniProt ID P09012
Cytogenetics 19q13.2
RefSeq Size 1646
RefSeq ORF 846
Synonyms Mud1; U1-A; U1A
Summary The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010]
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:U1A (SNRPA) (NM_004596) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301818 SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587) 10 ug
$3,255.00
LC417878 SNRPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417878 Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide A (SNRPA) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.