U1A (SNRPA) (NM_004596) Human Mass Spec Standard

SKU
PH301818
SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201818]
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>RC201818 protein sequence
Red=Cloning site Green=Tags(s)

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA
KK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004587
RefSeq Size 1646
RefSeq ORF 846
Synonyms Mud1; U1-A; U1A
Locus ID 6626
UniProt ID P09012
Cytogenetics 19q13.2
Summary The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010]
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:U1A (SNRPA) (NM_004596) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417878 SNRPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417878 Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide A (SNRPA) 100 ug
$436.00
TP301818 Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.