U1A (SNRPA) (NM_004596) Human Recombinant Protein
SKU
TP301818L
Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA), 1 mg
$7,820.00
6 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201818 protein sequence
Red=Cloning site Green=Tags(s) MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA KK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | : OriGene human recombinant small nuclear ribonucleoprotein polypeptide A (SNRPA, Cat. #TP301818) was compared side-by-side with baculovirus based insect cell (BEVS) derived SNRPA in a phycoerythrin detecting Luminex assay. The human cell produced SNRPA is comparative or better in sensitivity than the insect cell produced SNRPA to detect autoantibodies in human serum samples. |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_004587 |
Locus ID | 6626 |
UniProt ID | P09012 |
Cytogenetics | 19q13.2 |
RefSeq Size | 1646 |
RefSeq ORF | 846 |
Synonyms | Mud1; U1-A; U1A |
Summary | The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.