SPOP (NM_001007229) Human Recombinant Protein

SKU
TP301551
Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201551 protein sequence
Red=Cloning site Green=Tags(s)

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA
EAYRSLASAQCPFLGPPRKRLKQS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity MS digestion standard (PMID: 28810879)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007230
Locus ID 8405
UniProt ID O43791
Cytogenetics 17q21.33
RefSeq Size 2982
RefSeq ORF 1122
Synonyms BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2
Summary This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SPOP (NM_001007229) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301551 SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230) 10 ug
$3,255.00
LC401186 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423451 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423453 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423454 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425209 SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401186 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 100 ug
$436.00
LY423451 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 100 ug
$436.00
LY423453 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 100 ug
$436.00
LY423454 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 100 ug
$436.00
LY425209 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.