OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPOP (NM_001007229) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301551
Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342120 Rabbit Polyclonal Anti-SPOP Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SPOP or NM_001007229"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201551 protein sequence
Red=Cloning site Green=Tags(s)

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR
VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD
FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE
FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY
ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA
EAYRSLASAQCPFLGPPRKRLKQS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity MS digestion standard (PMID: 28810879)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001007230
Locus ID 8405
UniProt ID O43791
Cytogenetics 17q21.33
RefSeq Size 2982
RefSeq ORF 1122
Synonyms BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2
Summary This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPOP" proteins (11)
SKU Description Size Price
PH301551 SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230) 10 ug
$3,360.00
LC401186 Lyophilized SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423451 Lyophilized SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423453 Lyophilized SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423454 Lyophilized SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425209 Lyophilized SPOP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401186 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY423451 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423453 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY423454 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY425209 Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

Quantification of mutant SPOP proteins in prostate cancer using mass spectrometry-based targeted proteomics
Wang, Barbieri, He et al
J Transl Med (2017) 15 (1), 175 DOI: 10.1186/s12967-017-1276-7
AI Summary: OriGene contributed to this study by providing recombinant SPOP protein, which was used as a reference standard for developing and validating the mass spectrometry-based assays.
Snippet: Recombinant SPOP protein was purchased from OriGene (Rockville, MD)
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products