SPOP (NM_001007229) Human Recombinant Protein
SKU
TP301551
Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6, 20 µg
$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201551 protein sequence
Red=Cloning site Green=Tags(s) MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA EAYRSLASAQCPFLGPPRKRLKQS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | MS digestion standard (PMID: 28810879) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001007230 |
Locus ID | 8405 |
UniProt ID | O43791 |
Cytogenetics | 17q21.33 |
RefSeq Size | 2982 |
RefSeq ORF | 1122 |
Synonyms | BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2 |
Summary | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301551 | SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230) | 10 ug |
$3,255.00
|
|
LC401186 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423451 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423453 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423454 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425209 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401186 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 | 100 ug |
$436.00
|
|
LY423451 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 | 100 ug |
$436.00
|
|
LY423453 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 | 100 ug |
$436.00
|
|
LY423454 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 | 100 ug |
$436.00
|
|
LY425209 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.